Collection: uoqowuerwehgflasfhdgfkasjyuwerwyeqrthgasdhkfcashwe-qwerqwedfjjlhh
-
...
Time and Tru Women's Velvet Pleated Midi Skirt, Sizes XS-XXXL
Vendor:WalmartRegular price $19.98Regular priceUnit price / perSale price $19.98 -
...
UGG® Hillmont Chelsea Boot (Men)
Vendor:Nordstrom RackRegular price $129.97Regular priceUnit price / perSale price $129.97 -
...
Stuart Weitzman Size 9.5 Stuart 100 Ankle Bootie (Women)
Vendor:Nordstrom RackRegular price $140.38Regular priceUnit price / perSale price $140.38 -
...
SwissGear Travel Tech Elite, Black Dot, Large
Vendor:AmazonRegular price $49.99Regular priceUnit price / perSale price $49.99 -
...
Ziploc XL Sandwich and Snack Bags with EasyGuide Texture, Plastic Storage Bags with Grip 'n Seal Technology, 90 Bags Total
Vendor:AmazonRegular price $4.99Regular priceUnit price / perSale price $4.99 -
...
CRAFTSMAN CMXEVBE17590 9 Gallon 4.25 Peak HP Wet Dry Vac, Portable Shop Vacuum Wet and Dry with Filter, Dust Bag, Hose and Attachments for Home, Garage and Automotive Cleaning
Vendor:AmazonRegular price $49.99Regular priceUnit price / perSale price $49.99 -
...
Rubik's Pack & Go, 3 Game Bundle Race Flip Capture 2-Player Sequence Board Games 3D Puzzle Travel Game Gift Set, for Adults & Kids Ages 7+ Amazon Exclusive
Vendor:AmazonRegular price $9.99Regular priceUnit price / perSale price $9.99 -
...
Clip coupon Gator Golf - Putt The Ball into The Gator's Mouth to Score Game by Goliath, Single, Gator Golf, 27 x 27 x 12.5 cm for age 3+ years
Vendor:AmazonRegular price $6.66Regular priceUnit price / perSale price $6.66 -
...
Glad Tall Kitchen Drawstring Trash Bags - Odorshield 13 Gallon White Trash Bag, Febreze Fresh Clean, 110 Count
Vendor:AmazonRegular price $15.19Regular priceUnit price / perSale price $15.19 -
...
LG gram 2in1 16-Inch Lightweight Laptop 13th Gen Intel Core Processor i7-1360P Windows 11 Home 32GB RAM 1TB SSD - Black
Vendor:AmazonRegular price $999.99Regular priceUnit price / perSale price $999.99 -
...
Shyft DualRide with Carryall Storage Infant Car Seat and Stroller Combo (Durham Green)
Vendor:AmazonRegular price $290.15Regular priceUnit price / perSale price $290.15 -
...
Clip coupon Flipslide Game - Electronic Handheld Game | Addictive Multiplayer Puzzle Game of Skill | Flip, Slide & Match Colors to Beat the Clock | 4 Thrilling Game Modes | Ages 8+ | Includes Batteries
Vendor:AmazonRegular price $9.99Regular priceUnit price / perSale price $9.99 -
...
Clip coupon Aluminum Alloy 260W USB C Charger GaN Charger Fast USB C Charging Station 7 Ports 65W Laptop Charger for MacBook Pro/Air/iPad Pro/iPhone (Grey)
Vendor:AmazonRegular price $23.80Regular priceUnit price / perSale price $23.80 -
...
Drive Auto Car Trunk Organizer - Collapsible, Multi-Compartment Automotive SUV Car Organizer for Storage w/Adjustable Straps - Truck & Car Accessories for Women and Men - Grey
Vendor:AmazonRegular price $13.98Regular priceUnit price / perSale price $13.98 -
...
Remote Control Car, Two Wheel Rolling Stunt Car, 2.4GHz RC Crawlers with Light Music Drift, RC Cars for Kids Boys Girls Toy Gift Age 3 4 5 6 7 8-12 Year Old Birthday
Vendor:AmazonRegular price $9.99Regular priceUnit price / perSale price $9.99 -
...
Floafers Unisex-Child Prodigy (Toddler/Little Big Kid) Boat Shoe
Vendor:AmazonRegular price $22.39Regular priceUnit price / perSale price $22.39














